Zur Hauptnavigation wechseln Zur Suche wechseln Zum Hauptinhalt wechseln

Triiodothyronine Acts as a Smart Influencer on Hsp90 via a Triiodothyronine Binding Site

  • Lu Fan
  • , Athanasia Warnecke
  • , Julia Weder
  • , Matthias Preller
  • , Carsten Zeilinger*
  • *Korrespondierende*r Autor*in für diese Arbeit

Publikation: Beitrag in FachzeitschriftKurzmitteilungForschungPeer-Review

Abstract

Microarray-based experiments revealed that thyroid hormone triiodothyronine (T3) enhanced the binding of Cy5-labeled ATP on heat shock protein 90 (Hsp90). By molecular docking experiments with T3 on Hsp90, we identified a T3 binding site (TBS) near the ATP binding site on Hsp90. A synthetic peptide encoding HHHHHHRIKEIVKKHSQFIGYPITLFVEKE derived from the TBS on Hsp90 showed, in MST experiments, the binding of T3 at an EC50 of 50 µM. The binding motif can influence the activity of Hsp90 by hindering ATP accessibility or the release of ADP.

OriginalspracheEnglisch
Aufsatznummer7150
Seitenumfang6
FachzeitschriftInternational Journal of Molecular Sciences
Jahrgang23
Ausgabenummer13
Elektronisch veröffentlicht (E-Pub)28 Juni 2022
DOIs
PublikationsstatusVeröffentlicht - Juli 2022

ASJC Scopus Sachgebiete

  • Katalyse
  • Molekularbiologie
  • Spektroskopie
  • Angewandte Informatik
  • Physikalische und Theoretische Chemie
  • Organische Chemie
  • Anorganische Chemie

Dieses zitieren